PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.CC7W1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 461aa    MW: 50968.9 Da    PI: 6.5077
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.CC7W1genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-52151431128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s 
  Araip.CC7W1  15 VPPGFRFHPTEEELLQYYLRKKVSYEKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIYS- 110
                  69****************************.9***************964444222455**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  Araip.CC7W1 111 NGKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                  999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5910175IPR003441NAC domain
PROSITE profilePS5100557.35215175IPR003441NAC domain
PfamPF023651.8E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MPESMSISVN GQSQVPPGFR FHPTEEELLQ YYLRKKVSYE KIDLDVIRDV DLNKLEPWDI  60
QEKCKIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNTTND ANIVSNVMGD AAQEEGWVVC RIFKKKNHLK  180
TLDSPLTSSI SGDGGRRSHH HHHLFDSCDE GALEQILQQM GRGGGGGCKE EINNYDQSNN  240
NNNNNNNNYG GSSSLTTRYA RPFDTINNNV DSRFLKLPSL ESPKSTSMDH NNNNNNDNDD  300
SNENNGYHPI IPVEMVTENE GSFTCDNPNN MFHHHHLGGG GGGGSDGGGG LTNWVALDRL  360
VASQLNGQTE ASRQLSCFND PTMGYGTGNH DLLFPTVRST SSLTSSSASI NPRAVISAGA  420
GAYISPGAQD YTTTSEIDLW NFARSTSSLL SSSEPLCHVS N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4891789171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016185077.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-134NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0B2Q2T20.0A0A0B2Q2T2_GLYSO; NAC domain-containing protein 43
STRINGGLYMA16G02200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-118NAC family protein